peak-motifs MEgreenyellow

Motif discovery

Motif 1 oligos_6-7nt_m1

k-mer sig=3.26; evalue=0.00055

ysbCaCaTGGch

DGCCATGTGVSR

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor ysbCaCaTGGch

O11:MA1816.1:JASPAR O11/MA1816.1/JASPAR D 12 1.0000 0.772 0.772 NA NA

BIM1:MA0964.2:JASPAR BIM1/MA0964.2/JASPAR D 12 1.0000 0.742 0.742 NA NA

PIF3:MA0560.1:JASPAR PIF3/MA0560.1/JASPAR R 10 0.8333 0.860 0.716 NA NA

Total matches= 149 (146 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 268 (26.72%)
Max nb of predicted sites per peak: 4
(gene-Lalb_Chr10g0098911)
Mean nb of predicted sites per peak: 1.28

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 2 oligos_6-7nt_m2

k-mer sig=2.24; evalue=0.0058

tmttaATaAGtkr

YMACTTATTAAKA

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor tmttaATaAGtkr

ZHD1:MA1329.2:JASPAR ZHD1/MA1329.2/JASPAR R 13 1.0000 0.805 0.805 NA NA

ATHB13:MA1212.1:JASPAR ATHB13/MA1212.1/JASPAR D 11 0.8462 0.740 0.627 NA NA

ATHB24.ampDAP:M0858:AthalianaCistrome ATHB24.ampDAP/M0858/AthalianaCistrome R 13 0.8667 0.719 0.623 NA NA

Total matches= 60 (57 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 96 (9.57%)
Max nb of predicted sites per peak: 2
(gene-Lalb_Chr21g0318491)
Mean nb of predicted sites per peak: 1.09

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 3 oligos_6-7nt_m3

k-mer sig=1.33; evalue=0.047

scAATTATgys

SRCATAATTGS

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor scAATTATgys

ATHB20:MA1209.1:JASPAR ATHB20/MA1209.1/JASPAR R 11 1.0000 0.892 0.892 NA NA

HAT5.DAP:M0442:AthalianaCistrome HAT5.DAP/M0442/AthalianaCistrome R 11 1.0000 0.890 0.890 NA NA

ATHB13:MA1212.1:JASPAR ATHB13/MA1212.1/JASPAR R 11 1.0000 0.885 0.885 NA NA

Total matches= 119 (116 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 12 (1.20%)
Max nb of predicted sites per peak: 1
(gene-Lalb_Chr24g0398901)
Mean nb of predicted sites per peak: 1.00

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 4 oligos_6-7nt_m4

k-mer sig=0.85; evalue=0.14

kgsCaCGtGssm

KSSCACGTGSCM

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor kgsCaCGtGssm

O11:MA1816.1:JASPAR O11/MA1816.1/JASPAR R 12 1.0000 0.952 0.952 NA NA

BIM1:MA0964.2:JASPAR BIM1/MA0964.2/JASPAR D 12 1.0000 0.927 0.927 NA NA

HYH:MA1425.1:JASPAR HYH/MA1425.1/JASPAR D 12 1.0000 0.885 0.885 NA NA

Total matches= 257 (254 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 139 (13.86%)
Max nb of predicted sites per peak: 6
(gene-Lalb_Chr06g0167481)
Mean nb of predicted sites per peak: 2.25

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 5 oligos_6-7nt_m5

k-mer sig=2.24; evalue=0.0058

vwaaaTaaGtdd

HHACTTATTTWB

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor vwaaaTaaGtdd

HAT5.DAP:M0442:AthalianaCistrome HAT5.DAP/M0442/AthalianaCistrome D 11 0.9167 0.708 0.649 NA NA

SRM1:MA1681.1:JASPAR SRM1/MA1681.1/JASPAR D 12 0.8571 0.713 0.611 NA NA

CDF5:UN0360.1:JASPAR CDF5/UN0360.1/JASPAR D 10 0.8333 0.725 0.604 NA NA

Total matches= 65 (62 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 127 (12.66%)
Max nb of predicted sites per peak: 2
(gene-Lalb_Chr25g0279191)
Mean nb of predicted sites per peak: 1.15

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 6 oligos_6-7nt_m6

k-mer sig=0.75; evalue=0.18

arCCGTtaarm

KYTTAACGGYT

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor arCCGTtaarm

MYB98:M1333_1.02:CISBP MYB98/M1333_1.02/CISBP D 11 1.0000 0.763 0.763 NA NA

MYB52:MYB52:ArabidopsisPBM MYB52/MYB52/ArabidopsisPBM R 10 0.9091 0.818 0.744 NA NA

MYB98:MA1392.2:JASPAR MYB98/MA1392.2/JASPAR D 11 1.0000 0.736 0.736 NA NA

Total matches= 95 (92 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 52 (5.18%)
Max nb of predicted sites per peak: 2
(gene-Lalb_Chr12g0200991)
Mean nb of predicted sites per peak: 1.02

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 7 oligos_6-7nt_m7

k-mer sig=0.60; evalue=0.25

ksGGaCaCgh

DCGTGTCCSM

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor ksGGaCaCgh

GLYMA-08G357600:UN0420.1:JASPAR GLYMA-08G357600/UN0420.1/JASPAR R 9 0.8182 0.829 0.678 NA NA

GLYMA-07G038400:MA1809.1:JASPAR GLYMA-07G038400/MA1809.1/JASPAR D 10 0.9091 0.718 0.653 NA NA

ABF3:MA0930.2:JASPAR ABF3/MA0930.2/JASPAR R 9 0.8182 0.793 0.648 NA NA

Total matches= 72 (69 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 176 (17.55%)
Max nb of predicted sites per peak: 4
(gene-Lalb_Chr21g0309481)
Mean nb of predicted sites per peak: 1.18

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 8 oligos_6-7nt_m8

k-mer sig=0.24; evalue=0.58

srCCCaTAms

SKTATGGGYS

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor srCCCaTAms

1200010153:M1391_1.02:CISBP 1200010153/M1391_1.02/CISBP D 9 0.8182 0.715 0.585 NA NA

TZP2:EEAD0062:EEADannot TZP2/EEAD0062/EEADannot R 10 0.6667 0.719 0.479 NA NA

AGL3:MA0001.1:JASPAR AGL3/MA0001.1/JASPAR D 7 0.5385 0.853 0.459 NA NA

Total matches= 6 (3 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 296 (29.51%)
Max nb of predicted sites per peak: 5
(gene-Lalb_Chr21g0309481)
Mean nb of predicted sites per peak: 1.31

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 9 dyads_test_vs_ctrl_m1

k-mer sig=2.47; evalue=0.0034

gkCaCATGtGms

SKCACATGTGMC

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor gkCaCATGtGms

ARF4_DYAD0:EEAD0024:EEADannot ARF4_DYAD0/EEAD0024/EEADannot D 10 0.8333 0.860 0.717 NA NA

BMY2:MA2375.1:JASPAR BMY2/MA2375.1/JASPAR D 11 0.9167 0.738 0.676 NA NA

AT4G18890:MA1333.1:JASPAR AT4G18890/MA1333.1/JASPAR R 11 0.9167 0.718 0.658 NA NA

Total matches= 42 (39 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 59 (5.88%)
Max nb of predicted sites per peak: 4
(gene-Lalb_Chr23g0277811)
Mean nb of predicted sites per peak: 1.97

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 10 dyads_test_vs_ctrl_m2

k-mer sig=1.74; evalue=0.018

sstaTawtwaatss

SSATTWAWTATASS

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor sstaTawtwaatss

ATHB24.ampDAP:M0858:AthalianaCistrome ATHB24.ampDAP/M0858/AthalianaCistrome D 14 0.9333 0.744 0.694 NA NA

ATHB24:MA1330.1:JASPAR ATHB24/MA1330.1/JASPAR D 14 0.9333 0.718 0.670 NA NA

ATHB22:M0844_1.02:CISBP ATHB22/M0844_1.02/CISBP D 13 0.9286 0.708 0.657 NA NA

Total matches= 55 (52 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 46 (4.59%)
Max nb of predicted sites per peak: 2
(gene-Lalb_Chr07g0179341)
Mean nb of predicted sites per peak: 1.02

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 11 dyads_test_vs_ctrl_m3

k-mer sig=2.47; evalue=0.0034

wmtaasayrtgmkwyttcCaatda

THATTGGAARWMKCAYRTSTTAKW

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor wmtaasayrtgmkwyttcCaatda

Total matches= 0

No match

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 76 (7.58%)
Max nb of predicted sites per peak: 2
(gene-Lalb_Chr25g0282901)
Mean nb of predicted sites per peak: 1.05

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 12 dyads_test_vs_ctrl_m4

k-mer sig=2.47; evalue=0.0034

wrtaasayrtGmkwcktataatrd

HYATTATAMGWMKCAYRTSTTAYW

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor wrtaasayrtGmkwcktataatrd

Total matches= 0

No match

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 75 (7.48%)
Max nb of predicted sites per peak: 2
(gene-Lalb_Chr25g0278851)
Mean nb of predicted sites per peak: 1.05

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 13 dyads_test_vs_ctrl_m5

k-mer sig=2.47; evalue=0.0034

saaCCryrtgrwmkwwcGsaCGbg

CVCGTSCGWWMKWYCAYRYGGTTS

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor saaCCryrtgrwmkwwcGsaCGbg

Total matches= 0

No match

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 67 (6.68%)
Max nb of predicted sites per peak: 2
(gene-Lalb_Chr20g0119741)
Mean nb of predicted sites per peak: 1.12

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 14 dyads_test_vs_ctrl_m6

k-mer sig=2.47; evalue=0.0034

tmtatcayrwGkwwrgctaagr

YCTTAGCYWWMCWYRTGATAKA

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor tmtatcayrwGkwwrgctaagr

Total matches= 0

No match

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 71 (7.08%)
Max nb of predicted sites per peak: 3
(gene-Lalb_Chr08g0231311)
Mean nb of predicted sites per peak: 1.11

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 15 dyads_test_vs_ctrl_m7

k-mer sig=2.47; evalue=0.0034

wyatAcayRkGmkwwbkttaks

SMTAAMVWWMKCMYRTGTATRW

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor wyatAcayRkGmkwwbkttaks

Total matches= 0

No match

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 89 (8.87%)
Max nb of predicted sites per peak: 2
(gene-Lalb_Chr17g0348211)
Mean nb of predicted sites per peak: 1.08

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 16 dyads_test_vs_ctrl_m8

k-mer sig=2.47; evalue=0.0034

rktGasrbrkgmkwwywsswwysRttaaag

CTTTAAYSRWWSSWRWWMKCMYVYSTCAMY

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor rktGasrbrkgmkwwywsswwysRttaaag

Total matches= 0

No match

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 84 (8.37%)
Max nb of predicted sites per peak: 2
(gene-Lalb_Chr24g0399281)
Mean nb of predicted sites per peak: 1.08

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 17 dyads_test_vs_ctrl_m9

k-mer sig=2.47; evalue=0.0034

yyaatcabrwgkwyatsswwwwttasb

VSTAAWWWWSSATRWMCWYVTGATTRR

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor yyaatcabrwgkwyatsswwwwttasb

ATHB34.ampDAP:M0854:AthalianaCistrome ATHB34.ampDAP/M0854/AthalianaCistrome D 15 0.5556 0.726 0.403 NA NA

Total matches= 1

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 59 (5.88%)
Max nb of predicted sites per peak: 3
(gene-Lalb_Chr12g0200991)
Mean nb of predicted sites per peak: 1.08

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 18 dyads_test_vs_ctrl_m10

k-mer sig=2.47; evalue=0.0034

bkatCrygtGGwmkwwyatGams

SKTCATRWWMKWCCACRYGATMV

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor bkatCrygtGGwmkwwyatGams

Total matches= 0

No match

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 84 (8.37%)
Max nb of predicted sites per peak: 3
(gene-Lalb_Chr18g0059771)
Mean nb of predicted sites per peak: 1.05

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Word significance table
Word comparisons		[tab] [html] [heatmap]
Comparisons between discovered motifs
Discovered motifs versus discovered motifs		[ Discovered motif(s): tf ] [ table: html txt ] [ alignments (logo): html text ] [ clustering: html ] [ graph: gml (for CytoScape) ]
Discovered motifs versus transcription factor databases
Motifs versus footprintDB-plants database		[ table: html txt ] [ alignments (logo): html text ] [ graph: gml (for CytoScape) ]

Log files
Parameters and files		[txt] [html]
Time log		[time table] [time log] [html]

RSAT - peak-motifs result

Analysis: MEgreenyellow_Up2 (25/05/2025 13:52)

Command

Sequence composition

Discovered motifs (by algorithm)

Discovered motifs (with motif comparison)

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor wmtaasayrtgmkwyttcCaatda

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor wrtaasayrtGmkwcktataatrd

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor saaCCryrtgrwmkwwcGsaCGbg

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor tmtatcayrwGkwwrgctaagr

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor wyatAcayRkGmkwwbkttaks

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor rktGasrbrkgmkwwywsswwysRttaaag

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor yyaatcabrwgkwyatsswwwwttasb

ATHB34.ampDAP:M0854:AthalianaCistrome ATHB34.ampDAP/M0854/AthalianaCistrome D 15 0.5556 0.726 0.403 NA NA

Total matches= 1

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor bkatCrygtGGwmkwwyatGams

Total matches= 0

Motif locations (sites)

Motif comparisons

Logs and parameter files

Publications

Results

RSAT - peak-motifs result

Analysis: MEgreenyellow_Up2 (25/05/2025 13:52)

Command

Sequence composition

Discovered motifs (by algorithm)

Discovered motifs (with motif comparison)

footprintDB-plants name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match columns aligned correlation cor wmtaasayrtgmkwyttcCaatda Total matches= 0

footprintDB-plants name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match columns aligned correlation cor wrtaasayrtGmkwcktataatrd Total matches= 0

footprintDB-plants name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match columns aligned correlation cor saaCCryrtgrwmkwwcGsaCGbg Total matches= 0

footprintDB-plants name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match columns aligned correlation cor tmtatcayrwGkwwrgctaagr Total matches= 0

footprintDB-plants name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match columns aligned correlation cor wyatAcayRkGmkwwbkttaks Total matches= 0

footprintDB-plants name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match columns aligned correlation cor rktGasrbrkgmkwwywsswwysRttaaag Total matches= 0

footprintDB-plants name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match columns aligned correlation cor yyaatcabrwgkwyatsswwwwttasb ATHB34.ampDAP:M0854:AthalianaCistrome ATHB34.ampDAP/M0854/AthalianaCistrome D 15 0.5556 0.726 0.403 NA NA Total matches= 1

footprintDB-plants name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match columns aligned correlation cor bkatCrygtGGwmkwwyatGams Total matches= 0

Motif locations (sites)

Motif comparisons

Logs and parameter files

Publications

Results

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor wmtaasayrtgmkwyttcCaatda

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor wrtaasayrtGmkwcktataatrd

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor saaCCryrtgrwmkwwcGsaCGbg

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor tmtatcayrwGkwwrgctaagr

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor wyatAcayRkGmkwwbkttaks

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor rktGasrbrkgmkwwywsswwysRttaaag

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor yyaatcabrwgkwyatsswwwwttasb

ATHB34.ampDAP:M0854:AthalianaCistrome ATHB34.ampDAP/M0854/AthalianaCistrome D 15 0.5556 0.726 0.403 NA NA

Total matches= 1

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor bkatCrygtGGwmkwwyatGams

Total matches= 0