peak-motifs MEsteelblue

Motif discovery

Motif 1 oligos_6nt_test_vs_ctrl_m1

k-mer sig=4.97; evalue=1.1e-05

mmaACGTGCaas

STTGCACGTTKK

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor mmaACGTGCaas

HBI1:MA1025.1:JASPAR HBI1/MA1025.1/JASPAR R 12 1.0000 0.771 0.771 NA NA

AT2G18300:M0155_1.02:CISBP AT2G18300/M0155_1.02/CISBP R 12 1.0000 0.770 0.770 NA NA

ABF2:MA0941.1:JASPAR ABF2/MA0941.1/JASPAR R 12 0.9231 0.725 0.669 NA NA

Total matches= 157 (154 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 55 (25.23%)
Max nb of predicted sites per peak: 4
(gene-Lalb_Chr23g0269451)
Mean nb of predicted sites per peak: 1.20

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 2 oligos_6nt_test_vs_ctrl_m2

k-mer sig=4.02; evalue=9.5e-05

baTATTAAsga

TCSTTAATATV

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor baTATTAAsga

ANL2:M0850_1.02:CISBP ANL2/M0850_1.02/CISBP D 11 1.0000 0.707 0.707 NA NA

ATHB23:MA1327.2:JASPAR ATHB23/MA1327.2/JASPAR D 10 0.9091 0.760 0.691 NA NA

ATML1:M0852_1.02:CISBP ATML1/M0852_1.02/CISBP R 10 0.9091 0.753 0.684 NA NA

Total matches= 60 (57 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 9 (4.13%)
Max nb of predicted sites per peak: 1
(gene-Lalb_Chr18g0056951)
Mean nb of predicted sites per peak: 1.00

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 3 oligos_6nt_test_vs_ctrl_m3

k-mer sig=3.53; evalue=0.0003

srtGCACGtCmc

GKGACGTGCAYS

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor srtGCACGtCmc

HBI1:MA1025.1:JASPAR HBI1/MA1025.1/JASPAR D 12 1.0000 0.805 0.805 NA NA

AT2G18300:M0155_1.02:CISBP AT2G18300/M0155_1.02/CISBP D 12 1.0000 0.804 0.804 NA NA

0300010311:M0363_1.02:CISBP 0300010311/M0363_1.02/CISBP R 11 0.9167 0.825 0.756 NA NA

Total matches= 233 (230 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 71 (32.57%)
Max nb of predicted sites per peak: 4
(gene-Lalb_Chr02g0151751)
Mean nb of predicted sites per peak: 1.32

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 4 oligos_6nt_test_vs_ctrl_m4

k-mer sig=1.30; evalue=0.05

mmaaGTCAACtgra

TYCAGTTGACTTKK

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor mmaaGTCAACtgra

WRKY29.ampDAP:M0796:AthalianaCistrome WRKY29.ampDAP/M0796/AthalianaCistrome D 13 0.9286 0.907 0.842 NA NA

WRKY27.ampDAP:M0793:AthalianaCistrome WRKY27.ampDAP/M0793/AthalianaCistrome D 13 0.9286 0.893 0.830 NA NA

WRKY22:MA1303.1:JASPAR WRKY22/MA1303.1/JASPAR D 13 0.9286 0.893 0.829 NA NA

Total matches= 210 (207 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 41 (18.81%)
Max nb of predicted sites per peak: 2
(gene-Lalb_Chr19g0124751)
Mean nb of predicted sites per peak: 1.15

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 5 oligos_6nt_test_vs_ctrl_m5

k-mer sig=4.97; evalue=1.1e-05

vmaaCGtGsrr

YYSCACGTTKB

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor vmaaCGtGsrr

0300010311:M0363_1.02:CISBP 0300010311/M0363_1.02/CISBP D 11 1.0000 0.846 0.846 NA NA

LOC_Os02g49560:M0327_1.02:CISBP LOC_Os02g49560/M0327_1.02/CISBP R 11 1.0000 0.842 0.842 NA NA

bZIP11:bZIP10_1:EEAD0108:EEADannot bZIP11:bZIP10_1/EEAD0108/EEADannot R 11 1.0000 0.814 0.814 NA NA

Total matches= 301 (298 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 87 (39.91%)
Max nb of predicted sites per peak: 3
(gene-Lalb_Chr23g0269451)
Mean nb of predicted sites per peak: 1.37

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 6 oligos_6nt_test_vs_ctrl_m6

k-mer sig=0.48; evalue=0.33

srtGCACGass

SSTCGTGCAYS

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor srtGCACGass

MYC3:M0165_1.02:CISBP MYC3/M0165_1.02/CISBP R 10 0.9091 0.775 0.704 NA NA

HBI1:MA1025.1:JASPAR HBI1/MA1025.1/JASPAR D 11 0.9167 0.767 0.703 NA NA

AT2G18300:M0155_1.02:CISBP AT2G18300/M0155_1.02/CISBP D 11 0.9167 0.765 0.701 NA NA

Total matches= 148 (145 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 47 (21.56%)
Max nb of predicted sites per peak: 3
(gene-Lalb_Chr23g0269451)
Mean nb of predicted sites per peak: 1.40

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 7 oligos_7nt_test_vs_ctrl_m1

k-mer sig=1.81; evalue=0.015

rgwGaCGTGCayv

BRTGCACGTCWCY

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor rgwGaCGTGCayv

HYH:MA1425.1:JASPAR HYH/MA1425.1/JASPAR D 12 0.9231 0.825 0.761 NA NA

ABF4:MA1659.1:JASPAR ABF4/MA1659.1/JASPAR R 12 0.9231 0.813 0.750 NA NA

HBI1:MA1025.1:JASPAR HBI1/MA1025.1/JASPAR R 12 0.9231 0.795 0.734 NA NA

Total matches= 202 (199 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 70 (32.11%)
Max nb of predicted sites per peak: 4
(gene-Lalb_Chr02g0151751)
Mean nb of predicted sites per peak: 1.31

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 8 oligos_7nt_test_vs_ctrl_m2

k-mer sig=1.02; evalue=0.095

krCaaCGTGCays

SRTGCACGTTGYM

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor krCaaCGTGCays

HBI1:MA1025.1:JASPAR HBI1/MA1025.1/JASPAR R 12 0.9231 0.767 0.708 NA NA

AT2G18300:M0155_1.02:CISBP AT2G18300/M0155_1.02/CISBP R 12 0.9231 0.767 0.708 NA NA

BHLH74:MA1360.2:JASPAR BHLH74/MA1360.2/JASPAR R 13 0.9286 0.750 0.696 NA NA

Total matches= 122 (119 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 58 (26.61%)
Max nb of predicted sites per peak: 3
(gene-Lalb_Chr23g0269451)
Mean nb of predicted sites per peak: 1.24

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 9 oligos_7nt_test_vs_ctrl_m3

k-mer sig=0.38; evalue=0.42

asATATTAAss

SSTTAATATST

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor asATATTAAss

RVE1.ampDAP:M0594:AthalianaCistrome RVE1.ampDAP/M0594/AthalianaCistrome D 10 0.9091 0.709 0.645 NA NA

ATML1:M0852_1.02:CISBP ATML1/M0852_1.02/CISBP R 10 0.9091 0.707 0.642 NA NA

ATHB22:M0844_1.02:CISBP ATHB22/M0844_1.02/CISBP R 11 0.8462 0.745 0.631 NA NA

Total matches= 28 (25 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 96 (44.04%)
Max nb of predicted sites per peak: 4
(gene-Lalb_Chr23g0269331)
Mean nb of predicted sites per peak: 1.32

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 10 oligos_8nt_test_vs_ctrl_m1

k-mer sig=1.55; evalue=0.028

wkaGaCGtGCrs

SYGCACGTCTMW

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor wkaGaCGtGCrs

HYH:MA1425.1:JASPAR HYH/MA1425.1/JASPAR D 12 1.0000 0.742 0.742 NA NA

ABF4:MA1659.1:JASPAR ABF4/MA1659.1/JASPAR R 12 1.0000 0.734 0.734 NA NA

AT1G78700:MA1331.1:JASPAR AT1G78700/MA1331.1/JASPAR R 11 0.9167 0.764 0.700 NA NA

Total matches= 102 (99 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 56 (25.69%)
Max nb of predicted sites per peak: 3
(gene-Lalb_Chr20g0116741)
Mean nb of predicted sites per peak: 1.21

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 11 oligos_8nt_test_vs_ctrl_m2

k-mer sig=0.62; evalue=0.24

avaCaACGTGsk

MSCACGTTGTBT

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor avaCaACGTGsk

BEE2:M0161_1.02:CISBP BEE2/M0161_1.02/CISBP R 10 0.8333 0.705 0.588 NA NA

BZIP17:M0263_1.02:CISBP BZIP17/M0263_1.02/CISBP D 10 0.8333 0.703 0.586 NA NA

BEE2:MA0956.1:JASPAR BEE2/MA0956.1/JASPAR D 10 0.8333 0.703 0.586 NA NA

Total matches= 97 (94 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 64 (29.36%)
Max nb of predicted sites per peak: 2
(gene-Lalb_Chr24g0403581)
Mean nb of predicted sites per peak: 1.20

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 12 oligos_8nt_test_vs_ctrl_m3

k-mer sig=0.57; evalue=0.27

amAtattaACww

WWGTTAATATKT

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor amAtattaACww

Protein:6ryl_ABC:3D-footprint Protein/6ryl_ABC/3D-footprint D 12 0.8571 0.714 0.612 NA NA

PRH:M1167_1.02:CISBP PRH/M1167_1.02/CISBP D 8 0.6667 0.821 0.548 NA NA

YAB1:UN0415.1:JASPAR YAB1/UN0415.1/JASPAR D 8 0.6667 0.806 0.537 NA NA

Total matches= 28 (25 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 35 (16.06%)
Max nb of predicted sites per peak: 2
(gene-Lalb_Chr20g0118401)
Mean nb of predicted sites per peak: 1.09

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 13 oligos_8nt_test_vs_ctrl_m4

k-mer sig=0.14; evalue=0.72

srAGTCAACTyw

WRAGTTGACTYS

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor srAGTCAACTyw

AT3G42860:UN0354.1:JASPAR AT3G42860/UN0354.1/JASPAR D 12 1.0000 0.859 0.859 NA NA

WRKY55:MA1305.1:JASPAR WRKY55/MA1305.1/JASPAR R 12 1.0000 0.844 0.844 NA NA

WRKY29.ampDAP:M0796:AthalianaCistrome WRKY29.ampDAP/M0796/AthalianaCistrome D 12 0.9231 0.888 0.820 NA NA

Total matches= 219 (216 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 32 (14.68%)
Max nb of predicted sites per peak: 1
(gene-Lalb_Chr25g0281291)
Mean nb of predicted sites per peak: 1.00

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 14 dyads_test_vs_ctrl_m1

k-mer sig=4.29; evalue=5.1e-05

mvaACGTGCmh

DKGCACGTTBK

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor mvaACGTGCmh

BEE2:M0161_1.02:CISBP BEE2/M0161_1.02/CISBP R 10 0.9091 0.783 0.712 NA NA

LOC_Os02g49560:M0327_1.02:CISBP LOC_Os02g49560/M0327_1.02/CISBP R 11 1.0000 0.711 0.711 NA NA

BEE2:MA0956.1:JASPAR BEE2/MA0956.1/JASPAR D 10 0.9091 0.782 0.711 NA NA

Total matches= 151 (148 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 55 (25.23%)
Max nb of predicted sites per peak: 3
(gene-Lalb_Chr23g0269451)
Mean nb of predicted sites per peak: 1.16

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 15 dyads_test_vs_ctrl_m2

k-mer sig=3.09; evalue=0.00081

baTATTAAss

SSTTAATATV

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor baTATTAAss

ATHB23:MA1327.2:JASPAR ATHB23/MA1327.2/JASPAR D 10 1.0000 0.766 0.766 NA NA

ATML1:M0852_1.02:CISBP ATML1/M0852_1.02/CISBP R 10 1.0000 0.753 0.753 NA NA

WOX11:UN0413.2:JASPAR WOX11/UN0413.2/JASPAR R 10 1.0000 0.714 0.714 NA NA

Total matches= 70 (67 more)

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 7 (3.21%)
Max nb of predicted sites per peak: 1
(gene-Lalb_Chr18g0056951)
Mean nb of predicted sites per peak: 1.00

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 16 dyads_test_vs_ctrl_m3

k-mer sig=4.29; evalue=5.1e-05

dhTatvmsbkbkdygwwtaagr

YCTTAWWCRHMVMVSKBATADH

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor dhTatvmsbkbkdygwwtaagr

Total matches= 0

No match

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 22 (10.09%)
Max nb of predicted sites per peak: 2
(gene-Lalb_Chr21g0310841)
Mean nb of predicted sites per peak: 1.14

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 17 dyads_test_vs_ctrl_m4

k-mer sig=4.29; evalue=5.1e-05

hkaatvcsskskrykarmrwwasyktatrk

MYATAMRSTWWYKYTMRYMSMSSGBATTMD

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor hkaatvcsskskrykarmrwwasyktatrk

Total matches= 0

No match

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 25 (11.47%)
Max nb of predicted sites per peak: 2
(gene-Lalb_Chr23g0272211)
Mean nb of predicted sites per peak: 1.12

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 18 dyads_test_vs_ctrl_m5

k-mer sig=4.29; evalue=5.1e-05

bsCaCGysskGwywsGkrmtyacgcb

VGCGTRAKYMCSWRWCMSSRCGTGSV

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor bsCaCGysskGwywsGkrmtyacgcb

GT3a:MA1207.1:JASPAR GT3a/MA1207.1/JASPAR D 17 0.6538 0.701 0.458 NA NA

bHLH77:MA1362.1:JASPAR bHLH77/MA1362.1/JASPAR R 15 0.5769 0.704 0.406 NA NA

Total matches= 2

[ match table: html text ]
[ alignments (logos): html text ]

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 47 (21.56%)
Max nb of predicted sites per peak: 4
(gene-Lalb_Chr14g0372771)
Mean nb of predicted sites per peak: 1.21

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 19 dyads_test_vs_ctrl_m6

k-mer sig=4.29; evalue=5.1e-05

ssrCAcsgssdmkwbrkwcrwwagkcgs

SCGMCTWWYGWMYVWMKHSSCSGTGYSS

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor ssrCAcsgssdmkwbrkwcrwwagkcgs

Total matches= 0

No match

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 26 (11.93%)
Max nb of predicted sites per peak: 2
(gene-Lalb_Chr13g0302661)
Mean nb of predicted sites per peak: 1.04

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Motif 20 dyads_test_vs_ctrl_m7

k-mer sig=4.29; evalue=5.1e-05

rkcaTvmsSKskrsGramgwwAyavgbb

VVCBTRTWWCKTYCSYMSMSSKBATGMY

[ k-mers: statistics assemblies ]
[ matrix: tab_format transfac_format ]

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor rkcaTvmsSKskrsGramgwwAyavgbb

Total matches= 0

No match

Predicted sites on test peaks

Distribution of sites

Nb of predicted sites per peak

Nb peaks with at least one predicted site: 28 (12.84%)
Max nb of predicted sites per peak: 3
(gene-Lalb_Chr22g0351061)
Mean nb of predicted sites per peak: 1.36

[ sites: text ]
[ distribution: text ]
[ sites per peak: text ]
[ enrichment: text graph ]

Word significance table
Word comparisons		[tab] [html] [heatmap]
Comparisons between discovered motifs
Discovered motifs versus discovered motifs		[ Discovered motif(s): tf ] [ table: html txt ] [ alignments (logo): html text ] [ clustering: html ] [ graph: gml (for CytoScape) ]
Discovered motifs versus transcription factor databases
Motifs versus footprintDB-plants database		[ table: html txt ] [ alignments (logo): html text ] [ graph: gml (for CytoScape) ]

Log files
Parameters and files		[txt] [html]
Time log		[time table] [time log] [html]

RSAT - peak-motifs result

Analysis: MEsteelblue_Up1 (25/05/2025 14:12)

Command

Sequence composition

Discovered motifs (by algorithm)

Discovered motifs (with motif comparison)

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor dhTatvmsbkbkdygwwtaagr

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor hkaatvcsskskrykarmrwwasyktatrk

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor ssrCAcsgssdmkwbrkwcrwwagkcgs

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor rkcaTvmsSKskrsGramgwwAyavgbb

Total matches= 0

Motif locations (sites)

Motif comparisons

Logs and parameter files

Publications

Results

RSAT - peak-motifs result

Analysis: MEsteelblue_Up1 (25/05/2025 14:12)

Command

Sequence composition

Discovered motifs (by algorithm)

Discovered motifs (with motif comparison)

footprintDB-plants name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match columns aligned correlation cor dhTatvmsbkbkdygwwtaagr Total matches= 0

footprintDB-plants name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match columns aligned correlation cor hkaatvcsskskrykarmrwwasyktatrk Total matches= 0

footprintDB-plants name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match columns aligned correlation cor ssrCAcsgssdmkwbrkwcrwwagkcgs Total matches= 0

footprintDB-plants name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match columns aligned correlation cor rkcaTvmsSKskrsGramgwwAyavgbb Total matches= 0

Motif locations (sites)

Motif comparisons

Logs and parameter files

Publications

Results

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor dhTatvmsbkbkdygwwtaagr

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor hkaatvcsskskrykarmrwwasyktatrk

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor ssrCAcsgssdmkwbrkwcrwwagkcgs

Total matches= 0

footprintDB-plants

name id strand Nb overlap % Pearson Normalized aligned col. motif aligned col. match

columns aligned correlation cor rkcaTvmsSKskrsGramgwwAyavgbb

Total matches= 0